PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g10075.5.p
Common NameBRADI_3g10075, LOC104583495
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 300aa    MW: 33034 Da    PI: 7.6105
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g10075.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.54.1e-102331648
                      HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      v+ lG+++W+tIa  m+  R+++qc++rw  yl
  Bradi3g10075.5.p  2 VQNLGTKNWSTIACAMP-LRSRYQCRERWTYYL 33
                      899**************.9**********9886 PP

2Myb_DNA-binding48.61.8e-153983147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r++W+++++  l++a++++G++ W+  a+ ++ gRt+k +k++w+ +
  Bradi3g10075.5.p 39 RQAWSEQDEVTLIHAHEMHGNK-WRELAKLFP-GRTGKAVKNHWNGH 83
                      89********************.*********.***********966 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071713135IPR001005SANT/Myb domain
PROSITE profilePS5129410.176133IPR017930Myb domain
CDDcd001671.68E-6133No hitNo description
Gene3DG3DSA:1.10.10.602.0E-13240IPR009057Homeodomain-like
PfamPF002491.2E-7233IPR001005SANT/Myb domain
SuperFamilySSF466892.81E-241390IPR009057Homeodomain-like
PROSITE profilePS5129424.5793488IPR017930Myb domain
SMARTSM007176.2E-143886IPR001005SANT/Myb domain
PfamPF002492.5E-143981IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-204189IPR009057Homeodomain-like
CDDcd001676.94E-114181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MVQNLGTKNW STIACAMPLR SRYQCRERWT YYLNPALNRQ AWSEQDEVTL IHAHEMHGNK  60
WRELAKLFPG RTGKAVKNHW NGHMKRKLKS YLARGLPKQF QNLPVDPSVS NRGWSTPKGS  120
QDSFNNNQLP SDLLIWSESK RGLTETGENA SMLDGQSSDS IRSVSEGKPM SSSPKGFGAR  180
SADAQPKVDA GDGQIDRVVS KFPVVTDNDM ETVVSSSSVD LKVCVAAPSF VRSTSEEKQM  240
SYTGLSPAHS SQSRYAHLDE LSELHQSDIA DLLDMSYCES LMIIPPDSPQ SGNGGVPGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2418821108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756282.10.0PREDICTED: myb-related protein B-like isoform X3
RefseqXP_014756280.10.0PREDICTED: myb-related protein B-like isoform X1
TrEMBLA0A0Q3PY290.0A0A0Q3PY29_BRADI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.12e-34myb domain protein 3r-4